Protein coding transcript 24812

• Transcript: Ll_transcript_390070
• CDS coordinates: 135-902 (+)
• Peptide sequence: MEGSVVYNHRTVEEVFSDFKGRRTSIINALTTDVQHFFQQCDPDKENLCLYGFPSEHWEVNLPAEEVPPELPEPVLGINFARDGMQQKDWLTLVAVHSDAWLLSVAFYFGAKFGFDKADRKRLFTMINDLPTISEVVSGLAKKQGKEKSSVSNHSSNKPKSNSKRGSEPQAKNSRAMQLKDEDENGFEEEDEEEPGETNCGACGENYITGQFWICCDICERWFHGKCVKITQARADHIKIYKCPSCSHKRSRPLP*
• ORF Type: complete

Annotations of Ll_transcript_390070

• Blastp: PHD finger protein ALFIN-LIKE 5 from Arabidopsis with 68.32% of identity
• Blastx: PHD finger protein ALFIN-LIKE 5 from Arabidopsis with 64.17% of identity
• Eggnog: Finger protein(ENOG410YG6P)
• Kegg: Link to kegg annotations (AT5G20510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437834.1)
• Pfam: Alfin (PF12165.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;