Transcript | Ll_transcript_212145 |
---|---|
CDS coordinates | 196-1416 (+) |
Peptide sequence | MPPKWSLGYQQCRWSYLSDQRVLEVTRTFREKRIPCDVIWMDIDYMDGFRCFTFDKEHFPDPKSLVKDLHYNGFKAIWMLDPGIKLEEGYFVCDSGSKNDVWVQKADGAPFVGDVWPGPCVFPDYTQSKVREWWANLVKEFISNGVDGIWNDMNEPAIFKVVTKTMPESNVHRGDEELGGCQNHSFYHNVYGLLMAKSTYEGMKLANEKKRPFVLTRAGFVGSQRYAATWTGDNLSTWEHLHMSISMVLQMGLSGQPLSGPDIGGFAGNASPRLFGRWMGIGSLFPFCRGHSEKSTSDHEPWSFGEECEEVCRLALKRRYRLIPLIYTLFYFAHTRGTPVATPTFFADPKDPTLRKLENSFLLGPVLVYASTLRDQGLDKLDCTLPKGIWLSFDFDDVHPDLPALFL |
ORF Type | 3prime_partial |
Blastp | Alpha-glucosidase 2 from Bacillus with 44.27% of identity |
---|---|
Blastx | Alpha-glucosidase 2 from Bacillus with 43.78% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421474.1) |
Pfam | Glycosyl hydrolases family 31 (PF01055.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer