Protein coding transcript 248179

• Transcript: Ll_transcript_211269
• CDS coordinates: 2-316 (+)
• Peptide sequence: QRSIANYNECPLQVFIHDPLYKWALSPLKALQRQKDMDDDLVTSLEDPQNDYEGNKDAARALLRVKQKLDGYEEGEMRSIHGQVQQLIQDAIDSERLCQMFPGWG
• ORF Type: internal

Annotations of Ll_transcript_211269

• Blastp: Serine/threonine-protein kinase ATM from Arabidopsis with 75.53% of identity
• Blastx: Serine/threonine-protein kinase ATM from Arabidopsis with 75.53% of identity
• Eggnog: ataxia telangiectasia mutated(ENOG410XNPY)
• Kegg: Link to kegg annotations (AT3G48190)
• CantataDB: Link to cantataDB annotations (CNT0001712)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416968.1)
• Pfam: FATC domain (PF02260.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;