Protein coding transcript 2482

• Transcript: Ll_transcript_524758
• CDS coordinates: 3-542 (+)
• Peptide sequence: FPSLMKKSIMSNKITLAIFFLLNVIFASSDSKSDSKAYILALQWPNTTCFMNGKTISKTVKNPKSFGIHGLWPSNSEQTSKEPFPKDGFKSLCPQTLQMEIPIYWPNMIEDNNAKLWSIEWNKHGRCSGFDICTYFWNTLGLFKTLRAINLVGELEKASKFFILISNILYIICLIISNY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524758

• Blastp: Ribonuclease T2 from Homo with 33.33% of identity
• Blastx: Ribonuclease T2 from Homo with 33.33% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (8635)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447192.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;