Transcript | Ll_transcript_524848 |
---|---|
CDS coordinates | 3-338 (+) |
Peptide sequence | PSSLDLRHSKTPRQLISHVPNRWIGTHSPVKMTLYYTLVFGLLVFEMLLFCSLIVPMPFKIKRGLFEFISHNPLVAKLQYGMKITFIFILILFVDSVNRVYRVQLELAMAKQ |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Uncharacterized protein C9E9.04 from Schizosaccharomyces with 45.57% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC9E9.04) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_012569559.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer