Transcript | Ll_transcript_212866 |
---|---|
CDS coordinates | 2200-3084 (+) |
Peptide sequence | MAKRMHGGQVLQLELQANESKAEYEKKIQELEWHLANARKQVKDLEAFSESRYFNWKNKEHTYQSFLNSQHRAIQKLRAGMKSIKNEVIKTKRSYMEEFKYFGTKIKGLAEAAENYHEVLAENRKLYNEVQDLKGNIRVYCRIRPFLPGQSQKHSTVEFVGDDGDLIVSNPLKPGKESRKHFKFNKVFGQATSQEEVFIDTQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSLSSNSDWGVNYRALHDLFHISQSRRTSIVYEVGVQMVEIYNEQVRDLLSSTGPQKRYPFS* |
ORF Type | complete |
Blastp | Kinesin-like protein KIN-14J from Arabidopsis with 59.31% of identity |
---|---|
Blastx | Kinesin-like protein KIN-14J from Arabidopsis with 56.14% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT1G63640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424125.1) |
Pfam | Microtubule binding (PF16796.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer