Transcript | Ll_transcript_212872 |
---|---|
CDS coordinates | 427-1239 (+) |
Peptide sequence | MDNLNGFPRGSVFEGSQLASLVNWINVVLPNFNLPLETSEEELRLWLRDGSVLCSILDKLVPGSVERGIDSLEELVGVERFLVALDDLGLPRFELSDLGQGSMLPVLHCLETLKTHFACNAARENIQSSRKRWDRSDLTSPEETDSCLKDASKIQRAVDGSVVSDGVASLDGLKSNELCQLKRGSHVDLSDAKLMELVKSNSLDTTSTELLFNIGNRILGDIFERKNGDVPHAQRAACLLRKILQVIELRYSNQAEGIKNVILTFFIHLP* |
ORF Type | complete |
Blastp | Kinesin-like protein KIN-14J from Arabidopsis with 40.73% of identity |
---|---|
Blastx | Kinesin-like protein KIN-14J from Arabidopsis with 39.92% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT1G63640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446582.1) |
Pfam | Calponin homology (CH) domain (PF00307.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer