Protein coding transcript 248359

• Transcript: Ll_transcript_212880
• CDS coordinates: 2218-3102 (+)
• Peptide sequence: MAKRMHGGQVLQLELQANESKAEYEKKIQELEWHLANARKQVKDLEAFSESRYFNWKNKEHTYQSFLNSQHRAIQKLRAGMKSIKNEVIKTKRSYMEEFKYFGTKIKGLAEAAENYHEVLAENRKLYNEVQDLKGNIRVYCRIRPFLPGQSQKHSTVEFVGDDGDLIVSNPLKPGKESRKHFKFNKVFGQATSQEEVFIDTQPLIRSVLDGYNVCIFAYGQTGSGKTYTMSGPSLSSNSDWGVNYRALHDLFHISQSRRTSIVYEVGVQMVEIYNEQVRDLLSSTGPQKRYPFS*
• ORF Type: complete

Annotations of Ll_transcript_212880

• Blastp: Kinesin-like protein KIN-14J from Arabidopsis with 59.31% of identity
• Blastx: Kinesin-like protein KIN-14J from Arabidopsis with 56.14% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT1G63640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424125.1)
• Pfam: Microtubule binding (PF16796.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;