| Transcript | Ll_transcript_210941 |
|---|---|
| CDS coordinates | 221-538 (+) |
| Peptide sequence | MAVVMKQLDRAEEAIEAIKSFRGLCSKHSQESLDNVLLDLYKKCGRIDEQIELLKRKLRLIYQGEAFNGKTTRTARSHGKKFQVSIRQETARLLVIKFIQIFICP* |
| ORF Type | complete |
| Blastp | Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 81.91% of identity |
|---|---|
| Blastx | Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 81.3% of identity |
| Eggnog | male sterility MS5 family protein(ENOG410YFAS) |
| Kegg | Link to kegg annotations (AT5G48850) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450500.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer