Protein coding transcript 248408

• Transcript: Ll_transcript_210932
• CDS coordinates: 221-904 (+)
• Peptide sequence: MAVVMKQLDRAEEAIEAIKSFRGLCSKHSQESLDNVLLDLYKKCGRIDEQIELLKRKLRLIYQGEAFNGKTTRTARSHGKKFQVSIRQETARLLGNLGWAYMQKANYMMAEVIFKKAQMIDADSNKACNLSLSLMKQSRYEEASFILNDILQGKLPGSDEFKSRKRAEELLEELNSNMPQPQFINTLGLDDDFVKGIDELLNAWGSNRSRRLPIFEEISSFRDQLAC*
• ORF Type: complete

Annotations of Ll_transcript_210932

• Blastp: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 63.36% of identity
• Blastx: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 65.13% of identity
• Eggnog: male sterility MS5 family protein(ENOG410YFAS)
• Kegg: Link to kegg annotations (AT5G48850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450500.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;