Transcript | Ll_transcript_210932 |
---|---|
CDS coordinates | 221-904 (+) |
Peptide sequence | MAVVMKQLDRAEEAIEAIKSFRGLCSKHSQESLDNVLLDLYKKCGRIDEQIELLKRKLRLIYQGEAFNGKTTRTARSHGKKFQVSIRQETARLLGNLGWAYMQKANYMMAEVIFKKAQMIDADSNKACNLSLSLMKQSRYEEASFILNDILQGKLPGSDEFKSRKRAEELLEELNSNMPQPQFINTLGLDDDFVKGIDELLNAWGSNRSRRLPIFEEISSFRDQLAC* |
ORF Type | complete |
Blastp | Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 63.36% of identity |
---|---|
Blastx | Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 65.13% of identity |
Eggnog | male sterility MS5 family protein(ENOG410YFAS) |
Kegg | Link to kegg annotations (AT5G48850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450500.1) |
Pfam | Tetratricopeptide repeat (PF13181.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer