Protein coding transcript 248411

• Transcript: Ll_transcript_210939
• CDS coordinates: 161-1063 (+)
• Peptide sequence: MEVSVSMLKKSLLSKWKKDDLFHVIHKVPYGDSPYVKAKHAQLVDKDPETAIALFWKAINVGDKVDSALKDMAVVMKQLDRAEEAIEAIKSFRYLCSKHSQESLDNVLIDLYKKCGRVEDQIELLKKKLRMIYQGGAFNGKPTKTARSHGKKFQVSIKQETARLLGNLGWAYMQKANYMMAEVVFKKAQMIDSDANKACNLVLCLIKQSRFEEASLILDDVVQGKIPGSSDFKSRKRANELLEELNDKLPIQEFSVDILGFDDGLMKGLDQVLNAFGGSNRSRRLPIFEEISSFRDQLAC*
• ORF Type: complete

Annotations of Ll_transcript_210939

• Blastp: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 67.01% of identity
• Blastx: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 67.14% of identity
• Eggnog: male sterility MS5 family protein(ENOG410YFAS)
• Kegg: Link to kegg annotations (AT5G48850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448705.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;