Protein coding transcript 248412

• Transcript: Ll_transcript_210940
• CDS coordinates: 881-1264 (+)
• Peptide sequence: MQKANYMMAEVIFKKAQMIDADANKACNLCLCLMRQSRYEEANSILKDILQGKFPGSDEFKSRRRAEELLKELNINLSPQSQFMNILGFDDEFVKGIGELLYAWGSSRSRRLPIFEEISSFRDQLAC*
• ORF Type: complete

Annotations of Ll_transcript_210940

• Blastp: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 46.21% of identity
• Blastx: Protein SULFUR DEFICIENCY-INDUCED 1 from Arabidopsis with 81.82% of identity
• Eggnog: male sterility MS5 family protein(ENOG410YFAS)
• Kegg: Link to kegg annotations (AT5G48850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434492.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;