Protein coding transcript 24853

• Transcript: Ll_transcript_391574
• CDS coordinates: 1-435 (+)
• Peptide sequence: VELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEELSKVEGKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATLRRVHAAQKDDDMPPIEAILAPLEAELKLARQEMAKLQDDNKALDRLTKSKEAALLEAE
• ORF Type: internal

Annotations of Ll_transcript_391574

• Blastp: Microtubule-associated protein 70-1 from Arabidopsis with 89.66% of identity
• Blastx: Microtubule-associated protein 70-4 from Arabidopsis with 89.66% of identity
• Eggnog: Microtubule-associated protein(ENOG410ZDCM)
• Kegg: Link to kegg annotations (AT1G68060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421725.1)
• Pfam: Microtubule-associated protein 70 (PF07058.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;