Transcript | Ll_transcript_210435 |
---|---|
CDS coordinates | 95-751 (+) |
Peptide sequence | MEKGENSSTTEQDSSSDDHNLTIPFGLTRDEFETLKPVIKEHHTYTSGPGQCSTLLAQRINSPPQTVWSVVRRFDKPQLYKHFIKSCFVKEPFNMTVGCTRDVNVISGLPAATSTERLDILDDDRHVTGFSIVGGEHRLRNYCSVTSVHGFDRDGEIWTVVLESYIVDVPEGNTEEDTRLFADTVVKLNLQKLASLTEGMNRDADSKYIQLFNEEGRI* |
ORF Type | complete |
Blastp | Abscisic acid receptor PYR1 from Arabidopsis with 69.23% of identity |
---|---|
Blastx | Abscisic acid receptor PYR1 from Arabidopsis with 69.23% of identity |
Eggnog | abscisic acid receptor(ENOG410YDHK) |
Kegg | Link to kegg annotations (AT4G17870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445319.1) |
Pfam | Polyketide cyclase / dehydrase and lipid transport (PF10604.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer