Transcript | Ll_transcript_211705 |
---|---|
CDS coordinates | 343-672 (+) |
Peptide sequence | MSLTEKEQMLEDMKGLLQDADEKRQASLTELSAKHQKNIESLEAQLNDALSDRSKATESISSLQVLVAEKESKIAEMEAASTGEAARLRAAVESVKGEMSHLKQQHVWF* |
ORF Type | complete |
Blastp | Protein GRIP from Arabidopsis with 70.59% of identity |
---|---|
Blastx | Protein GRIP from Arabidopsis with 70.16% of identity |
Eggnog | NA(ENOG410XSCF) |
Kegg | Link to kegg annotations (AT5G66030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444880.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer