Protein coding transcript 24864

• Transcript: Ll_transcript_390503
• CDS coordinates: 87-524 (+)
• Peptide sequence: MGSKTLMDFWQPSSKRLKQTLTPSISKSDDPTTTSLSLHQKARIQHNKLLAKSKRNLNLCLQKVSDSKSKGEFLALEELLVEDTWLEALNGELEKPYAITLSKFVETEISSGNYVYPPSHLIFNALNSTPFHTVKAVILGQVSST*
• ORF Type: complete

Annotations of Ll_transcript_390503

• Blastp: Uracil-DNA glycosylase, mitochondrial from Arabidopsis with 45.56% of identity
• Blastx: Uracil-DNA glycosylase, mitochondrial from Arabidopsis with 45.56% of identity
• Eggnog: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine (By similarity)(COG0692)
• Kegg: Link to kegg annotations (AT3G18630)
• CantataDB: Link to cantataDB annotations (CNT0000175)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450955.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;