Protein coding transcript 248673

• Transcript: Ll_transcript_211415
• CDS coordinates: 2-319 (-)
• Peptide sequence: MHQQNIQNQSLHFVLSTDAKPRLKWNPELHQRFIEATNQLGGAEKATPKSLMRVMGIPGLTLYHLKSYLQKYRLGKSQQVETCSDNNQQDYKEIKCSDDDHCSKEI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_211415

• Blastp: Myb-related protein 2 from Arabidopsis with 80% of identity
• Blastx: Myb-related protein 2 from Arabidopsis with 80% of identity
• Eggnog: Transcription factor(ENOG410Y9RE)
• Kegg: Link to kegg annotations (AT3G04030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459045.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;