Protein coding transcript 248682

• Transcript: Ll_transcript_211009
• CDS coordinates: 321-1148 (+)
• Peptide sequence: MASFTSMSSAGSLAAPPHNLSSSASISAFPFAAGRRQNSNTVVLVRKNRNTRVSAMAKELHFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTAKALVAELKKISKEVEDSELADVAAVSAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEKMAVEFDNCKV*
• ORF Type: complete

Annotations of Ll_transcript_211009

• Blastp: RuBisCO large subunit-binding protein subunit beta, chloroplastic from Pisum with 90.33% of identity
• Blastx: Chaperonin 60 subunit beta 2, chloroplastic from Arabidopsis with 89.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443787.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;