Transcript | Ll_transcript_211019 |
---|---|
CDS coordinates | 2-736 (+) |
Peptide sequence | LAQGLIAEGVKVVAAGANPVLITRGIEKTAKALVAELKKISKEVEDSELADVAAVSAGNNYEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEKMAVEFENCKLLLVDKKISNARDLINILEDAITNGFPILVIAEDIEQEALATLVVNKLRGSLKIAALKAPGFGERKSQYLDDIAVLTGGTVIREEVGLTLDKAGKEVLGHASKVVLTKDTTTIVGDGSTQD |
ORF Type | internal |
Blastp | RuBisCO large subunit-binding protein subunit beta, chloroplastic from Pisum with 94.29% of identity |
---|---|
Blastx | RuBisCO large subunit-binding protein subunit beta, chloroplastic from Pisum with 94.29% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425621.1) |
Pfam | TCP-1/cpn60 chaperonin family (PF00118.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer