Protein coding transcript 248728

• Transcript: Ll_transcript_210542
• CDS coordinates: 254-739 (+)
• Peptide sequence: MRSGGCALQQTLTAEAASVLKHSLGLARRRGHAQVTPLHVAATLLSLRASSFRRGCLKSQPHQTSHPLQCRALELCFNVALNKLPTRPAPFIHTSHQPSLSNALIAALKRAQAHQKRGCIEQQQQPLLIVKVELEQLILSILDDPSVSRVMREAGFSSTDVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_210542

• Blastp: Protein SMAX1-LIKE 5 from Arabidopsis with 65.79% of identity
• Blastx: Protein SMAX1-LIKE 5 from Arabidopsis with 65.79% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT5G57130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442723.1)
• Pfam: Clp amino terminal domain, pathogenicity island component (PF02861.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;