Protein coding transcript 248735

• Transcript: Ll_transcript_210533
• CDS coordinates: 470-952 (+)
• Peptide sequence: MSISKNPSHELETKLFSDKEQRDNCCEECTSNYEKEVQFIKTDQKKMLPFWLQSHNIEANQKDELTKLKTKWNRLCHCLHQSQQNQNKSSSNNNWNGKIYPYNSSSSISFANNTYSPNLVPSFQRQQSCIEFNFSDKNQATEPLLDSLEGMSEGECGMAF*
• ORF Type: complete

Annotations of Ll_transcript_210533

• Blastp: Protein SMAX1-LIKE 5 from Arabidopsis with 37.9% of identity
• Blastx: Protein SMAX1-LIKE 5 from Arabidopsis with 33.59% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT5G57130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442723.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;