Protein coding transcript 24878

• Transcript: Ll_transcript_391098
• CDS coordinates: 190-525 (+)
• Peptide sequence: MVQSASSSAGLRTIKRVEQTLHDLGVNLKPRVPTKAVCAEHLELRKEILTLLNLQKQVQYKEAEGSSFRDGSYGESPGTPKDQPFIPEFMSFGGERVGKKDHKRKGHGAPSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_391098

• Blastp: SWR1-complex protein 4 from Arabidopsis with 72.41% of identity
• Blastx: SWR1-complex protein 4 from Arabidopsis with 73.44% of identity
• Eggnog: DNA methyltransferase 1 associated protein 1(ENOG410XSA4)
• Kegg: Link to kegg annotations (AT2G47210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418319.1)
• Pfam: DNA methyltransferase 1-associated protein 1 (DMAP1) (PF05499.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;