Transcript | Ll_transcript_212069 |
---|---|
CDS coordinates | 82-699 (+) |
Peptide sequence | MPSQKRSFPFSLDDGDSFSHLSNHHLQQQQQPQQPKQHKDEDEEHEEVDEELEEAEEQGDAEEEEQGDAEEEEEQDDVDEEEEEEDEEEGQQQNNNNDEKPQDSDETPSSDSDDKSEFIYIELQDVRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDHNYDALIASLYPDIEKYEEEV* |
ORF Type | complete |
Blastp | Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 79.59% of identity |
---|---|
Blastx | Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 81.82% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G44280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433484.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13923.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer