Protein coding transcript 248789

• Transcript: Ll_transcript_212094
• CDS coordinates: 669-1232 (+)
• Peptide sequence: MDISRENQGTSRQVTRPRKLTWGGGGFRSHTRHGSGGGSNSKISRNGRLSKLVDHLRNLDESADEFEIHLMLVSVDKQSTPILQQPHLCCRPTTSVKHLCEYVACQTPLAVEEVEILAVKGCGSTKCDKATYDTSALICDKLTTLVIDPCKDDLEILQEHESLAGITSKCISKMEHLILAYRRKEAP*
• ORF Type: complete

Annotations of Ll_transcript_212094

• Blastp: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 40.43% of identity
• Blastx: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 38.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G44280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432121.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;