Protein coding transcript 248794

• Transcript: Ll_transcript_212102
• CDS coordinates: 1-483 (+)
• Peptide sequence: RRSLRDDPNYDALIAALYPDIEKYEEEELEFREEEKNRNKQIQASIAKVVQRQSEAMGKRRKDTPGTSVTRSQRNQRNIHSRRQNQVNDTQGSEDNDEDNDNNEKDSSSADERCTESRQSKRKRWTRVRPSQPSSSRASPDGGCIESDMDISRENQGTSRQ
• ORF Type: internal

Annotations of Ll_transcript_212102

• Blastp: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 48.52% of identity
• Blastx: Putative E3 ubiquitin-protein ligase RING1b from Arabidopsis with 65.22% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G44280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432180.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;