Protein coding transcript 2488

• Transcript: Ll_transcript_524844
• CDS coordinates: 44-613 (+)
• Peptide sequence: MASNSTTTYGSEPTTPNTTFVQADPSTFRSVVQQLTGASNDPSAPKLPLTLPSRLSSAQPHRPTTATAAAKKPIFKLHERRSSNNLQLNIGVSDMFHNNHYIVMNNVTLGGSNRGEMVNLIPSPVSPLEFLARGSPRTPKSPQQEEEQRVVVEKGFYLHPTTPKPSNTTPQLLPLFPLHSPKSNHNSSS*
• ORF Type: complete

Annotations of Ll_transcript_524844

• Blastp: VQ motif-containing protein 11 from Arabidopsis with 40.76% of identity
• Blastx: VQ motif-containing protein 11 from Arabidopsis with 39.66% of identity
• Eggnog: VQ motif-containing protein(ENOG410YVV0)
• Kegg: Link to kegg annotations (AT1G80450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454434.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;