Protein coding transcript 248802

• Transcript: Ll_transcript_212080
• CDS coordinates: 82-699 (+)
• Peptide sequence: MPSQKRSFPFSLDDGDSFSHLSNHHLQQQQQPQQPKQHKDEDEEHEEVDEELEEAEEQGDAEEEEQGDAEEEEEQDDVDEEEEEEDEEEGQQQNNNNDEKPQDSDETPSSDSDDKSEFIYIELQDVRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDHNYDALIASLYPDIEKYEEEV*
• ORF Type: complete

Annotations of Ll_transcript_212080

• Blastp: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 79.59% of identity
• Blastx: Putative E3 ubiquitin-protein ligase RING1a from Arabidopsis with 81.82% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G44280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433483.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13923.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;