Transcript | Ll_transcript_212444 |
---|---|
CDS coordinates | 436-1314 (+) |
Peptide sequence | MSSLEEPLGLDKLTSMSTIDRIQRFSSGACRPSVDNLGMGNCWIEGRSSSTSNSCNENNEEYTVETFPWKRQTRGMSRGDSFSQKTMTIGRNSMKIGMTDDPFSSSDYQYSPKCNSKEIQNMAYKFTKGIPKFVKIVEVGPRDGLQNEKSIVPTSVKIELIHRLASSGLSVIEATSFVSPKWVPQLADAKVVMKAVQHLDGIRLPVLTPNLKGFEAAVAAGAREVAVFASASESFSKSNINCSIDESLVRYRAVTRAANELSIPVRGYAFCFVFRYSYHPSNTVCLIALIYL* |
ORF Type | complete |
Blastp | Hydroxymethylglutaryl-CoA lyase, mitochondrial from Arabidopsis with 65.2% of identity |
---|---|
Blastx | Hydroxymethylglutaryl-CoA lyase, mitochondrial from Arabidopsis with 65.45% of identity |
Eggnog | Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3-hydroxy-4-methylpentanoate (2-isopropylmalate) (By similarity)(COG0119) |
Kegg | Link to kegg annotations (AT2G26800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432091.1) |
Pfam | HMGL-like (PF00682.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer