Protein coding transcript 248880

• Transcript: Ll_transcript_212438
• CDS coordinates: 634-1218 (+)
• Peptide sequence: MLFIVNVTAANFISVIFQISSSLFVLKYHRYVSCVVGCPVEGPISPSKVAYVAKELYNMGCFEISLGDTIGVGTPGTVVPMLAAVMAVVPKVKLAVHFHDTYGQSLANILVSLQMGISIVDSSVAGLGGCPYAKGASGNVATEDVVCMLNGLGVKTNIDLGKLMLAGDFISNHLGRPSGSKTAIALGRVSCLKQ*
• ORF Type: complete

Annotations of Ll_transcript_212438

• Blastp: Hydroxymethylglutaryl-CoA lyase, mitochondrial from Arabidopsis with 86.71% of identity
• Blastx: Hydroxymethylglutaryl-CoA lyase, mitochondrial from Arabidopsis with 86.71% of identity
• Eggnog: Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3-hydroxy-4-methylpentanoate (2-isopropylmalate) (By similarity)(COG0119)
• Kegg: Link to kegg annotations (AT2G26800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455920.1)
• Pfam: HMGL-like (PF00682.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;