Protein coding transcript 248913

• Transcript: Ll_transcript_31095
• CDS coordinates: 170-481 (+)
• Peptide sequence: MSSSGMVRKKKNGSIRSIFMHADGHDWFLMFLGFFGAIGDGFSIPLVLLITSKIMNNIGGSSINSGSTFIQKMNQNAVDLLYLAIGSFVACFLGEYQSWDKMF*
• ORF Type: complete

Annotations of Ll_transcript_31095

• Blastp: ABC transporter B family member 15 from Arabidopsis with 63.54% of identity
• Blastx: ABC transporter B family member 15 from Arabidopsis with 57.14% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT3G28345)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428490.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;