Transcript | Ll_transcript_31095 |
---|---|
CDS coordinates | 170-481 (+) |
Peptide sequence | MSSSGMVRKKKNGSIRSIFMHADGHDWFLMFLGFFGAIGDGFSIPLVLLITSKIMNNIGGSSINSGSTFIQKMNQNAVDLLYLAIGSFVACFLGEYQSWDKMF* |
ORF Type | complete |
Blastp | ABC transporter B family member 15 from Arabidopsis with 63.54% of identity |
---|---|
Blastx | ABC transporter B family member 15 from Arabidopsis with 57.14% of identity |
Eggnog | (ABC) transporter(COG1132) |
Kegg | Link to kegg annotations (AT3G28345) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428490.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer