Protein coding transcript 248916

• Transcript: Ll_transcript_32496
• CDS coordinates: 246-551 (+)
• Peptide sequence: MTVNSEPRHNCKVASSRRLQIRPLFDTWKKVVNGGEPRLRGCIGSLEARDLINGFRDYALSSALRDRRFPPIQAKELPSLECTVSILTDYETANYYLDWEVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_32496

• Blastp: Uncharacterized protein At2g38710 from Arabidopsis with 83.95% of identity
• Blastx: Uncharacterized protein At2g38710 from Arabidopsis with 83.95% of identity
• Eggnog: ammecr1 domain-containing protein(COG2078)
• Kegg: Link to kegg annotations (AT2G38710)
• CantataDB: Link to cantataDB annotations (CNT0002653)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427679.1)
• Pfam: AMMECR1 (PF01871.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;