Protein coding transcript 248917

• Transcript: Ll_transcript_32481
• CDS coordinates: 1957-2277 (+)
• Peptide sequence: MITQFEATVLCFSPLFVTWKKVVNGGEPRLRGCIGSLKACDLISGFRGYALTSALRDRRFPPIQAKELPSLECTVSILTDYETANDYLDWEVCADLLVLLLGFHLA*
• ORF Type: complete

Annotations of Ll_transcript_32481

• Blastp: Uncharacterized protein At2g38710 from Arabidopsis with 79.07% of identity
• Blastx: Uncharacterized protein At2g38710 from Arabidopsis with 85% of identity
• Eggnog: ammecr1 domain-containing protein(COG2078)
• Kegg: Link to kegg annotations (AT2G38710)
• CantataDB: Link to cantataDB annotations (CNT0002653)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020966672.1)
• Pfam: AMMECR1 (PF01871.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;