Transcript | Ll_transcript_32500 |
---|---|
CDS coordinates | 1066-1818 (+) |
Peptide sequence | MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLVGEKKVTSKLLQTSTSTEKMYKIDDHVACAVAGIMSDANILINTARVQAQRYTLAYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKNFGFQLYMSDPSGNYGGWKAGAIGANNQAAQSILKQDYKDEITREEAVQLALKVLSKTMDSTSLTSDKLELAEVFLSPTGKVKYEVRSPESLTKLLVKHGVTQPATDTA* |
ORF Type | complete |
Blastp | Proteasome subunit alpha type-4-A from Arabidopsis with 90.8% of identity |
---|---|
Blastx | Proteasome subunit alpha type-4-A from Arabidopsis with 90.8% of identity |
Eggnog | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)(COG0638) |
Kegg | Link to kegg annotations (AT3G22110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446329.1) |
Pfam | Proteasome subunit A N-terminal signature (PF10584.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer