Protein coding transcript 248929

• Transcript: Ll_transcript_32504
• CDS coordinates: 103-396 (-)
• Peptide sequence: MSDPSGNYGGWKAGAIGANNQAAQSILKQDYKDEITREEAVQLAVKVLSKTMNSTSLTSDKLELQRFFSHSGKVKYEVCSSESLSKLLVTQPATDTA*
• ORF Type: complete

Annotations of Ll_transcript_32504

• Blastp: Proteasome subunit alpha type-4 from Petunia with 72.73% of identity
• Blastx: Proteasome subunit alpha type-4 from Petunia with 73.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462847.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;