Protein coding transcript 248991

• Transcript: Ll_transcript_30485
• CDS coordinates: 436-945 (+)
• Peptide sequence: MQGMFKANGGCGYVKKPDFLLKSGSNNEVFDPRVELPVKITLKVTVYMGEGWYYDFKHTHFDQFSPPDFYTRVGIAGVPNDTMMKKTKAVEDNWLPSWNEVFEFPLSIPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSQKGDKYTNVKLLMRFEFI*
• ORF Type: complete

Annotations of Ll_transcript_30485

• Blastp: Phosphoinositide phospholipase C 2 from Arabidopsis with 78.11% of identity
• Blastx: Phosphoinositide phospholipase C 2 from Arabidopsis with 73.33% of identity
• Eggnog: phospholipase c(ENOG410XPSW)
• Kegg: Link to kegg annotations (AT3G08510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417460.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;