| Transcript | Ll_transcript_30498 |
|---|---|
| CDS coordinates | 820-1119 (+) |
| Peptide sequence | MQVGIAGVPNDTMMKKTKAVEDNWLPSWNEVFEFPLSIPELALLRVEVHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSQKGDKYTNVKLLMRFEFI* |
| ORF Type | complete |
| Blastp | Phosphoinositide phospholipase C 2 from Arabidopsis with 76.53% of identity |
|---|---|
| Blastx | Phosphoinositide phospholipase C 2 from Arabidopsis with 76.53% of identity |
| Eggnog | phospholipase c(ENOG410XPSW) |
| Kegg | Link to kegg annotations (AT3G08510) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (NP_001235296.1) |
| Pfam | C2 domain (PF00168.29) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer