Transcript | Ll_transcript_31432 |
---|---|
CDS coordinates | 2-517 (+) |
Peptide sequence | VKPENFLLGQPGTADDKKLYLIDLGLASRWKDASSGLHVDYDQRPDIFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMGTSAELMCCFCPAPFKQFLEAVTNMRFDEEPNYSKLISLFDSLIEPCTPLRPIRIDGALKVVLMFL* |
ORF Type | 5prime_partial |
Blastp | Casein kinase 1-like protein HD16 from Oryza sativa with 86.83% of identity |
---|---|
Blastx | Casein kinase 1-like protein HD16 from Oryza sativa with 78.18% of identity |
Eggnog | Casein Kinase(ENOG410XPGP) |
Kegg | Link to kegg annotations (4334396) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458463.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer