Protein coding transcript 249030

• Transcript: Ll_transcript_31867
• CDS coordinates: 601-1353 (-)
• Peptide sequence: MYLRCFVFENPKAWVQMLPWAQFWYNASYHHSLKMSPFQAVFGRLPPSVIKYEFQATDPPFVQIALQERDQLLRQLRDNLLQSQNYMKMQADKKRRDFHLDVGDLALVKLQPYRQHSVALRKNKKLSLRYFGPFKVLKRIGKVAYQLQLPDSAKIHLVFHISLLKEFRSNSSQPYFPLPLTTIQQGPLVQPIKVLRTRLIMQNSIQLPQILVQWDTTDSQEATWEDLLEFQQAYPTSTLRTRLILMEGVL*
• ORF Type: complete

Annotations of Ll_transcript_31867

• Blastp: Transposon Tf2-6 polyprotein from Schizosaccharomyces with 31.91% of identity
• Blastx: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 30.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC27E2.08)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006598537.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;