Transcript | Ll_transcript_30409 |
---|---|
CDS coordinates | 1322-1786 (+) |
Peptide sequence | MGGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRETFTNLSEVWAKEVELYSTNPDCIKMLVGNKVDKEADRVVTKKEGIDFARECGCLFTECSAKTRVNEQQCFEELILKILDTPSLLAEGSKGVKKNIFKDKQSLSDASTSGCC* |
ORF Type | complete |
Blastp | Ras-related protein RABC1 from Arabidopsis with 85% of identity |
---|---|
Blastx | Ras-related protein RABC1 from Arabidopsis with 84.67% of identity |
Eggnog | Ras-related protein(ENOG410XPD0) |
Kegg | Link to kegg annotations (AT1G43890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464793.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer