Protein coding transcript 249049

• Transcript: Ll_transcript_30422
• CDS coordinates: 104-535 (+)
• Peptide sequence: MESSSTQEFDYLFKLLMIGDSGVGKSSLLLCFTSDSFEDLSPTIGVDFKVKYVTVDGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMIYDVTRRETFTNLSEIWAREIDLYSTNQDCIRMLVGNKVDKEGDRVVTKKEGIDF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30422

• Blastp: Ras-related protein RABC1 from Arabidopsis with 84.83% of identity
• Blastx: Ras-related protein RABC1 from Arabidopsis with 84.83% of identity
• Eggnog: Ras-related protein(ENOG410XPD0)
• Kegg: Link to kegg annotations (AT1G43890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414229.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;