Protein coding transcript 249050

• Transcript: Ll_transcript_30392
• CDS coordinates: 757-1275 (+)
• Peptide sequence: MSSFMSLAGVDFKVKYVLMGGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRETFTNLSEVWAKEVELYSTNPDCIKMLVGNKVDKEADRVVTKKEGIDFARECGCLFTECSAKTRVNEQQCFEELILKILDTPSLLAEGSKGVKKNIFKDKQSLSDASTSGCC*
• ORF Type: complete

Annotations of Ll_transcript_30392

• Blastp: Ras-related protein RABC1 from Arabidopsis with 84.67% of identity
• Blastx: Ras-related protein RABC1 from Arabidopsis with 84.67% of identity
• Eggnog: Ras-related protein(ENOG410XPD0)
• Kegg: Link to kegg annotations (AT1G43890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464793.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;