Transcript | Ll_transcript_30402 |
---|---|
CDS coordinates | 155-1315 (+) |
Peptide sequence | MGESEVIHSWSAPRSLSTSLMYSFAQRDDVEVLDEPLYAHFLRVTGVDRPYREEVLSKMERDGNKVVNDIIFAPGRKKYRFCKHMSKQRLQGLTDDLMKKGKHFILIRNPLDILPSFDKVVPPSFFEMGLAELVSIYNELRELGKPPPVIDAAELQQDPEATLRGLCDDLEIPFQPAMLNWEAGAKSIDGVWAPWWYSSVHKSTCFEEAKKYPQPFPFSHYDLLEQSLPLYNMLRRHVKRKSSLLSSPLPPPNLPVPANEKLLAWVGDEIVPRDSAKVSVFDSVVQGGDSVWEGLRVYNGKVFKLEEHLDRLFDSAKALAFENVPTRDEIKEAIFKTLIRNGMFDNSHIRLSLTRGKKVTSGMSPAFNLYGCTLIGNFISLHGCTK* |
ORF Type | complete |
Blastp | Branched-chain-amino-acid aminotransferase-like protein 2 from Arabidopsis with 78.44% of identity |
---|---|
Blastx | Branched-chain-amino-acid aminotransferase-like protein 2 from Arabidopsis with 78.44% of identity |
Eggnog | brancheD-chain amino acid aminotransferase(COG0115) |
Kegg | Link to kegg annotations (AT5G27410) |
CantataDB | Link to cantataDB annotations (CNT0001957) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419836.1) |
Pfam | Amino-transferase class IV (PF01063.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer