Protein coding transcript 249067

• Transcript: Ll_transcript_30406
• CDS coordinates: 834-1241 (+)
• Peptide sequence: MERDGNKVVNDIIFAPGRKKYRFCKHMSKQRLQGLTDDLMKKGKHFILIRNPLDILPSFDKVVPPSFFEMGLAELVSIYNELRELGKPPPVIDAAELQQDPEATLRGLCDDLEIPFQPAMLKYADLFFVLSEISN*
• ORF Type: complete

Annotations of Ll_transcript_30406

• Blastp: Branched-chain-amino-acid aminotransferase-like protein 1 from Arabidopsis with 70.73% of identity
• Blastx: Branched-chain-amino-acid aminotransferase-like protein 2 from Arabidopsis with 72.9% of identity
• Eggnog: brancheD-chain amino acid aminotransferase(COG0115)
• Kegg: Link to kegg annotations (AT3G05190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419837.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;