Protein coding transcript 249099

• Transcript: Ll_transcript_31472
• CDS coordinates: 525-1172 (+)
• Peptide sequence: MKAPPSNGNLPNSAEVERKTIDSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPSYPDLQSKLICRLQNVALHADPETDEVYAQMTLQPVNKYDKEAILASDMGFKQSRQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQELVAKDLHDSTWAFRHIYRGQPKRHLLTTGWSVFVSTKRVFAGDSVLFIR*
• ORF Type: complete

Annotations of Ll_transcript_31472

• Blastp: Auxin response factor 19 from Arabidopsis with 86.98% of identity
• Blastx: Auxin response factor 7 from Arabidopsis with 76.62% of identity
• Eggnog: auxin response factor(ENOG410YDIT)
• Kegg: Link to kegg annotations (AT1G19220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463844.1)
• Pfam: B3 DNA binding domain (PF02362.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;