Protein coding transcript 249104

• Transcript: Ll_transcript_31464
• CDS coordinates: 525-893 (+)
• Peptide sequence: MKAPPSNGNLPNSAEVERKTIDSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKQTDFIPSYPNLPSKLICMLRNVVLHVCALSSILRFIFLWYIPIFQLLPHIWNTPSHMDKLVC*
• ORF Type: complete

Annotations of Ll_transcript_31464

• Blastp: Auxin response factor 7 from Arabidopsis with 82.56% of identity
• Blastx: Auxin response factor 7 from Arabidopsis with 82.56% of identity
• Eggnog: auxin response factor(ENOG410YDIT)
• Kegg: Link to kegg annotations (AT5G20730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013458391.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;