Protein coding transcript 249119

• Transcript: Ll_transcript_31436
• CDS coordinates: 3152-4279 (+)
• Peptide sequence: MFMLSKTPSRNCDVNLLFCMDNLFCFIFYTINIISCFQEVPDNEFEKRIRPEVIPANEIGVTFADIGSLDDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTRPGEQILVLAATNRPFDLDEAIIRRFERRIMVGLPSADNREMILKTLLAKEKHENLDFKELATMTEGFSGSDLKNLCITAAYRPVRELIQQERRKDMEKKKKEPESQGSEDASSNEEDKEEVEIMLRPLNMEDMRQAKSQVAASFASEGAVMGELKQWNNLYGEGGSRKKEQLTYFL*
• ORF Type: complete

Annotations of Ll_transcript_31436

• Blastp: Uncharacterized AAA domain-containing protein C24B10.10c from Schizosaccharomyces with 47.57% of identity
• Blastx: Fidgetin-like protein 1 from Caenorhabditis with 48.51% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC24B10.10c)
• CantataDB: Link to cantataDB annotations (CNT0000090)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449731.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;