Protein coding transcript 249202

• Transcript: Ll_transcript_30285
• CDS coordinates: 2-421 (+)
• Peptide sequence: EKYSQSSSLPHHLEIHWFSIINSCVTVLLLTGFLATILMRVLKNDFMKYAQDEEAADDQEETGWKYIHGDVFRFPKSKSLFSAALGSGTQLFTLTIFIFMLALVGVFYPYNRGALFTALVVIYALTSGIAGYTATSFYIQ
• ORF Type: internal

Annotations of Ll_transcript_30285

• Blastp: Transmembrane 9 superfamily member 3 from Arabidopsis with 93.57% of identity
• Blastx: Transmembrane 9 superfamily member 3 from Arabidopsis with 93.57% of identity
• Eggnog: transmembrane 9 superfamily member(ENOG410XSVB)
• Kegg: Link to kegg annotations (AT2G01970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426173.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;