Transcript | Ll_transcript_30288 |
---|---|
CDS coordinates | 225-863 (+) |
Peptide sequence | MFSTFLFVFTISLFSFNVLSDSSNHRYNEGDNVPLYANKVGPFHNPSETYRYFDLPFCATGKEKDKTEALGEVLNGDRLVTAPYALDFKKDKDSKSVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDKEGKSDPSEYKYFLYKHIQFDVLYNKDHVIEISARMDPHSLVDLTEDKEVDTEFLYTVKWKETDTPFEKRMEKYSQ |
ORF Type | 3prime_partial |
Blastp | Transmembrane 9 superfamily member 2 from Arabidopsis with 75.59% of identity |
---|---|
Blastx | Transmembrane 9 superfamily member 2 from Arabidopsis with 75.59% of identity |
Eggnog | transmembrane 9 superfamily member(ENOG410XSVB) |
Kegg | Link to kegg annotations (AT1G14670) |
CantataDB | Link to cantataDB annotations (CNT0000658) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448161.1) |
Pfam | Endomembrane protein 70 (PF02990.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer