Protein coding transcript 249204

• Transcript: Ll_transcript_30288
• CDS coordinates: 225-863 (+)
• Peptide sequence: MFSTFLFVFTISLFSFNVLSDSSNHRYNEGDNVPLYANKVGPFHNPSETYRYFDLPFCATGKEKDKTEALGEVLNGDRLVTAPYALDFKKDKDSKSVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDKEGKSDPSEYKYFLYKHIQFDVLYNKDHVIEISARMDPHSLVDLTEDKEVDTEFLYTVKWKETDTPFEKRMEKYSQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_30288

• Blastp: Transmembrane 9 superfamily member 2 from Arabidopsis with 75.59% of identity
• Blastx: Transmembrane 9 superfamily member 2 from Arabidopsis with 75.59% of identity
• Eggnog: transmembrane 9 superfamily member(ENOG410XSVB)
• Kegg: Link to kegg annotations (AT1G14670)
• CantataDB: Link to cantataDB annotations (CNT0000658)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448161.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;