Protein coding transcript 24924

• Transcript: Ll_transcript_390429
• CDS coordinates: 1-411 (+)
• Peptide sequence: GSFIEYFEGLTYEHVNFIFSGASHAQESSYPSSSSFYKFGLSEVDSNPYYRYSHGDGLSHHQSPVDDYRRPLGNSPIVSEQTTTANTEWGESVNTDIRDNSFECPRRHHSNSDDYQVIWQDNIDPDDMTYEVRLEP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_390429

• Blastp: E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 31.16% of identity
• Blastx: E3 ubiquitin ligase BIG BROTHER from Arabidopsis with 59.18% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G63530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454117.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;