Protein coding transcript 249252

• Transcript: Ll_transcript_32069
• CDS coordinates: 1378-1986 (+)
• Peptide sequence: MSNAALHTIARNRPNMTRFRLCIIEPRTPDYLTLQPLDSGFGAIVEHCKDLQRLSLSGLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLANAAKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPDSRPDTCPVEKLYIYRTIAGPRSDMPGFVWTMKDDSSPRLE*
• ORF Type: complete

Annotations of Ll_transcript_32069

• Blastp: Protein TRANSPORT INHIBITOR RESPONSE 1 from Arabidopsis with 86.07% of identity
• Blastx: Protein TRANSPORT INHIBITOR RESPONSE 1 from Arabidopsis with 73.19% of identity
• Eggnog: F-box and leucine-rich repeat protein(ENOG410XQ54)
• Kegg: Link to kegg annotations (AT3G62980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421520.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;